Skip to content

etheleon/pymegan

Repository files navigation

Python package for MEGAN CE using the blast2lca tool

DOIzendoBadge

This is a collection of python classes for working with with MEGAN6 CE (v6.6.0). Now supports both GI and acc

Usage

fullPipeline <rootDirectory> <sampleDirectory> <sampleName> <inputFile.m8> <taxOutput> <koOutput> --blast2lca <path to blast2lca tool> --gi2kegg <gi2kegg or acc2kegg> --gi2taxid <gi2taxid of acc2taxid>

fullPipeline processes meganised DAA files as input into a tabular output where each query (DIAMOND) is given its constituent KEGG and NCBI taxonomy assignment.

required Directory structure

input

/root/directory
└── sampleDirectory/
     └── inputFile.daa / inputFile.m8

Output

/root/directory
└── sampleDirectory/
     ├── KOoutput
     ├── taxoutput
     └── inputFile.daa / inputFile.m8

Others

Docker

Running the image like how you would a binary/executable to convert the m8 diamond outputs into KO and TAXID tables

The image comes installed with MEGAN CE

If you’re using the older NCBI NR database used the nr_gi_0_1 tagged docker image.

docker pull etheleon/blast2lca:nr_gi_0_1

Example: Running the dockerised blast2lca executable

WORKDIR=/path/2/your/workdir
DIAMONDOUTPUT=/path/2/query.m8
GI2TAXID=/export2/home/uesu/simulation_fr_the_beginning/data/classifier/gi2taxid.refseq.map
GI2KEGG=/export2/home/uesu/github/MEGAN/tools/gi2kegg.map

docker run --rm \
   -v $WORKDIR:/data \
   -v $DIAMONDOUTPUT:/data/diamond.m8 \
   -v $GI2KEGG:/data/gi2kegg \
   -v $GI2TAXID:/data/gi2taxid \
    etheleon/blast2lca:nr_gi_0_1

for the new acc based NCBI NR database use the nr_acc_0_1 tagged docker image

docker pull etheleon/blast2lca:acc_gi_0_1

$GI2TAXID will point to the acc2taxid mapping file same for $GI2KEGG

parseMEGAN

If you already have the outputs from blast2lca, and you want to combine the annotations (ko and taxonomy for analysis)

usage: parseMEGAN [-h] [--verbose] root sampledir sample taxonomy kegg

Command line tool for processing blast2lca outputs

positional arguments:
  root        the root directory
  sampledir   relative path from root directory to sample directory
  sample      sample name, could be same name as sample directory
  taxonomy    blast2lca taxonomy output filename - has to be in taxIDs d__2
  kegg        blast2lca ko output filename

optional arguments:
  -h, --help  show this help message and exit
  --verbose   to switch on verbose mode

Accepts .bz2 files

./parseMEGAN $PWD \ 
	tests/trimmed/NUSM01AD00_M01_1_Day0 \
	NUSM01AD00_M01_1_Day0 \
	taxoutput.bz2 \
	KOoutput.bz2

input

/root/directory
└── sampleDirectory/
     ├── KOoutput
     └── taxoutput

Output

/root/directory
└── sampleDirectory/
     ├── sampleName-combined.txt
     ├── KOoutput
     └── taxoutput

Each query may have multiple KEGG annotations (top 10% of subjects in a blastx query may be mapped to subject GIs mapping to multiple KOs). In this case the combination parser only takes we just the 1st KO

Incorporating python class into your python script

Initialize

from MEGAN.process import Parser
lcaparser = Parser(
    "/export2/home/uesu/mouseData/",#rootPath
    "data/trimmed/NUSM01AD00_M01_1_Day0/", #sampledirectory
    "NUSM01AD00_M01_1_Day0", #sampleName
    "KOoutput",#kofile
    "taxoutput3"#taxfile
)

Input files

NOTE: The readID itself should not include any semi-colon character, if there is please remove it before running the parser.

KEGG

HISEQ:327:HN35KBCXX:2:2216:17590:101139/2; ; [1] K16363: 100 # 1
HISEQ:327:HN35KBCXX:2:2216:17505:101147/2; ;
HISEQ:327:HN35KBCXX:2:2216:18101:101081/2; ; [1] K16053: 100 # 1
HISEQ:327:HN35KBCXX:2:2216:18469:101047/2; ;
HISEQ:327:HN35KBCXX:2:2216:18275:101110/2; ; [1] K02621: 100 # 1
HISEQ:327:HN35KBCXX:2:2216:19012:101012/2; ;
HISEQ:327:HN35KBCXX:2:2216:19208:101184/2; ;
HISEQ:327:HN35KBCXX:2:2216:20173:101054/2; ;
HISEQ:327:HN35KBCXX:2:2216:20417:101000/2; ; [1] K02837: 100 # 1
HISEQ:327:HN35KBCXX:2:2216:20656:101185/2; ;

Taxonomy

HISEQ:327:HN35KBCXX:2:1101:17405:2046/1; ;d__2; 100;p__976; 100;c__200643; 100;o__171549; 100;f__171552; 80;g__838; 80;s__1262917; 20;
HISEQ:327:HN35KBCXX:2:1101:20056:2050/1; ;d__2; 100;p__1239; 100;c__186801; 100;o__186802; 100;f__186803; 76;g__189330; 40;s__1263073; 4;
HISEQ:327:HN35KBCXX:2:1101:19475:2499/1; ;d__2; 100;p__1239; 100;c__91061; 92;o__186826; 92;f__81852; 92;g__1350; 92;s__1351; 92;
HISEQ:327:HN35KBCXX:2:1101:16910:2803/1; ;d__2; 100;p__976; 100;c__200643; 100;o__171549; 100;f__815; 33;g__816; 33;s__1410607; 33;
HISEQ:327:HN35KBCXX:2:1101:20670:2813/1; ;d__2; 100;p__1239; 100;c__186801; 100;o__186802; 100;f__186803; 75;g__572511; 25;s__1226324; 13;
HISEQ:327:HN35KBCXX:2:1101:5294:3036/1; ;d__2; 100;p__976; 100;c__200643; 100;o__171549; 100;f__171552; 100;g__838; 100;s__1263102; 50;
HISEQ:327:HN35KBCXX:2:1101:10938:3042/1; ;d__2; 100;p__976; 100;c__200643; 100;o__171549; 100;f__171552; 100;g__838; 67;s__52227; 67;
HISEQ:327:HN35KBCXX:2:1101:7569:5698/1; ;d__2; 59;p__1239; 33;c__186801; 33;o__186802; 33;f__541000; 22;g__1263; 19;s__40519; 7;
HISEQ:327:HN35KBCXX:2:1101:11823:5595/1; ;d__2; 100;p__1239; 92;c__186801; 68;o__186802; 68;f__31979; 20;g__1485; 20;s__1262806; 4;
HISEQ:327:HN35KBCXX:2:1101:7035:5916/1; ;d__2; 100;p__976; 100;c__200643; 100;o__171549; 100;f__171551; 100;g__283168; 100;s__1263090; 50;

.megan summary format

lcaparser.singleComparison()

Combined format

We count reads which have the same taxons and KOs annotations

lcaparser.combined()
phylum  67820   K00000  4
phylum  1224    K06937  1
phylum  1224    K00656  6
phylum  1224    K04564  2
phylum  1224    K06934  1
phylum  1224    K12524  24
phylum  1224    K00558  7
phylum  1224    K02674  1
phylum  1224    K06694  1
phylum  1224    K01785  12
...

...
species 1262910 K00033  1
species 1262911 K00000  525
species 35760   K00000  14
species 7462    K15421  1
species 7462    K00000  1
species 1262918 K00000  365
species 1262919 K02429  5
species 1262919 K07133  1
species 1262919 K03800  1
species 1262919 K00000  529

Misc

Mapping tool generators, in the tools folder of the blast2lcaPlus repo, you’ll find the 3 folders:

  1. binaries
  2. gi2kegg
  3. ref2kegg

The map generators are written in golang, and the compiled versions are found in the binaries folder. Although to be safe, its best to compile it on your own machine.
The gi2kegg binary is meant for older NR databases before September 2016 when genebank identifiers (GI) are still supported by NCBI

The newer ref2kegg binary is meant for the newer NR databases after Sept 2016.

gi2kegg

In the example below, only gi|489223532|ref|WP_003131952.1| will be displayed as the subject when you carry out alignment against the NR database, but in the linker files from KEGG link kegg genes to the sub GIs

K00001|contig00001      gi|489223532|ref|WP_003131952.1|        81.8    390     71      0       1202    33      1       390     1.4e-185        656.8

above record is not accurate

>gi|489223532|ref|WP_003131952.1| 30S ribosomal protein S18 [Lactococcus lactis]gi|15674171|ref|NP_268346.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis Il1403]gi|116513137|ref|YP_812044.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris SK11]gi|125625229|ref|YP_001033712.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris MG1363]gi|281492845|ref|YP_003354825.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis KF147]gi|385831755|ref|YP_005869568.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis CV56]gi|385839508|ref|YP_005877138.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris A76]gi|389855617|ref|YP_006357861.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris NZ9000]gi|414075194|ref|YP_007000411.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris UC509.9]gi|459286377|ref|YP_007509482.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis IO-1]gi|544395586|ref|YP_008569870.1| ribosomal protein S18 RpsR [Lactococcus lactis subsp. cremoris KW2]gi|554464728|ref|YP_008703967.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis KLDS 4.0325]gi|13878750|sp|Q9CDN0.1|RS18_LACLA RecName: Full=30S ribosomal protein S18 [Lactococcus lactis subsp. lactis Il1403]gi|122939895|sp|Q02VU1.1|RS18_LACLS RecName: Full=30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris SK11]gi|166220956|sp|A2RNZ2.1|RS18_LACLM RecName: Full=30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris MG1363]gi|12725253|gb|AAK06287.1|AE006448_5 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis Il1403]gi|116108791|gb|ABJ73931.1| SSU ribosomal protein S18P [Lactococcus lactis subsp. cremoris SK11]gi|124494037|emb|CAL99037.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris MG1363]gi|281376497|gb|ADA65983.1| SSU ribosomal protein S18P [Lactococcus lactis subsp. lactis KF147]gi|300072039|gb|ADJ61439.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris NZ9000]gi|326407763|gb|ADZ64834.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis CV56]gi|354692797|gb|EHE92602.1| hypothetical protein LLCRE1631_01913 [Lactococcus lactis subsp. lactis CNCM I-1631]gi|358750736|gb|AEU41715.1| SSU ribosomal protein S18p [Lactococcus lactis subsp. cremoris A76]gi|374674265|dbj|BAL52156.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis IO-1]gi|413975114|gb|AFW92578.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris UC509.9]gi|525225771|emb|CDG05746.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis A12]gi|530789293|gb|EQC53187.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis bv. diacetylactis str. TIFN4]gi|530789525|gb|EQC53393.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis bv. diacetylactis str. TIFN2]gi|530791209|gb|EQC54683.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris TIFN6]gi|530793883|gb|EQC56744.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris TIFN5]gi|530859245|gb|EQC82878.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris TIFN7]gi|530868587|gb|EQC91162.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris TIFN1]gi|530872454|gb|EQC94448.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris TIFN3]gi|537110246|gb|ERE60813.1| 30S ribosomal protein S18 [Enterococcus gallinarum EGD-AAK12]gi|543873771|gb|AGV74185.1| ribosomal protein S18 RpsR [Lactococcus lactis subsp. cremoris KW2]gi|552065042|gb|AGY45032.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis KLDS 4.0325]gi|554892214|gb|ESK79551.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis bv. diacetylactis str. LD61]gi|666395058|gb|KEY61992.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. cremoris GE214]gi|669187288|gb|AII13743.1| 30S ribosomal protein S18 [Lactococcus lactis subsp. lactis NCDO 2118]
MAQQRRGGFKRRKKVDFIAANKIEVVDYKDTELLKRFISERGKILPRRVTGTSAKNQRKVVNAIKRARVMALLPFVAEDQ

ref2kegg

Usage

KEGG=/path/to/your/KEGG/FTP
./ref2kegg nr $KEGG/genes/links/genes_ncbi-proteinid.list $KEGG/genes/links/genes_ko.list > acc2ko.map

About

Python package and wrapper around MEGAN6 CE's blast2lca

Topics

Resources

License

Stars

Watchers

Forks

Packages

 
 
 

Contributors